PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr020201.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family Dof
Protein Properties Length: 326aa    MW: 34809.9 Da    PI: 7.6479
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr020201.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.19.2e-393291362
       zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                 ++alkcprCds ntkfCyynny+lsqPr+fCkaCrryWtkGG lrnvPvGgg+rk k+s+
  Pbr020201.1 32 QHALKCPRCDSLNTKFCYYNNYNLSQPRHFCKACRRYWTKGGVLRNVPVGGGCRKTKRSK 91
                 6789****************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-283089IPR003851Zinc finger, Dof-type
PfamPF027012.8E-333389IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.5623589IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103773IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MQDIHSVRGG GRFFGGSGGG DPRLRPHQHP NQHALKCPRC DSLNTKFCYY NNYNLSQPRH  60
FCKACRRYWT KGGVLRNVPV GGGCRKTKRS KTKNSSSSSP ISSPPPPPPQ PNSADQNKSS  120
SRSSSESSSL TNTTAAAATA ATEAVSEPSS TGSASNLLSN IHNPESSFFI SQGGANSGFE  180
PGASAAALLD HSTEINGIFS EIGSFTSLIT SSNDMPFSFG NINGSPFNQQ GNHDHNQVHQ  240
NQWGQQNQGV KMQEISAGLL DQTVQVDLSV FQNRSHVGGG GGFGSLDWQP GSGDQGLFDL  300
PNTVDQAYWS HSQWTDQDHP TLYLP*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00570DAPTransfer from AT5G60850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8572542e-62DQ857254.1 Glycine max Dof4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009346227.10.0PREDICTED: dof zinc finger protein DOF5.4
TrEMBLD9ZIX70.0D9ZIX7_MALDO; DOF domain class transcription factor
STRINGPOPTR_0015s03520.13e-85(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59983050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.17e-39OBF binding protein 4